PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010915633.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 312aa    MW: 35670.6 Da    PI: 7.6033
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010915633.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.75.4e-54101391128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeel+ +yL+kkv+ + ++l +vi++vd++k+ePwdL+ k ++ +  ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk++
  XP_010915633.1  10 VPPGFRFHPTDEELLYYYLRKKVAYEAIDL-DVIRDVDLNKLEPWDLKdKcRIGSgPQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKAI 103
                     69****************************.9***************943444443456************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + ++++ +g++ktLvfy+grap+g+ktdW+mheyrl
  XP_010915633.1 104 HLSNSKRIGMRKTLVFYTGRAPHGQKTDWIMHEYRL 139
                     **********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.05E-596159IPR003441NAC domain
PROSITE profilePS5100558.32410159IPR003441NAC domain
PfamPF023652.9E-2811139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MHPGNGQLAV PPGFRFHPTD EELLYYYLRK KVAYEAIDLD VIRDVDLNKL EPWDLKDKCR  60
IGSGPQNEWY FFSHKDKKYP TGTRTNRATT AGFWKATGRD KAIHLSNSKR IGMRKTLVFY  120
TGRAPHGQKT DWIMHEYRLD DESTDVQEDG WVVCRVFKKK NHQRGIPPEA ILEDDQLDPL  180
RANGYASMEQ KQNFQLPCNF SFDSNMHLPQ LLSSESTIPP LMPPVSMNAL DLECSQNLMK  240
LTSGNGGGPL PHERFTGNWS ILDKLLASHQ NLDQLIQSKC NPLSQLMDMG SSVHRFPLQY  300
LGCEADLLKF SK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-51716114167NO APICAL MERISTEM PROTEIN
1ut4_B3e-51716114167NO APICAL MERISTEM PROTEIN
1ut7_A3e-51716114167NO APICAL MERISTEM PROTEIN
1ut7_B3e-51716114167NO APICAL MERISTEM PROTEIN
3swm_A3e-51716117170NAC domain-containing protein 19
3swm_B3e-51716117170NAC domain-containing protein 19
3swm_C3e-51716117170NAC domain-containing protein 19
3swm_D3e-51716117170NAC domain-containing protein 19
3swp_A3e-51716117170NAC domain-containing protein 19
3swp_B3e-51716117170NAC domain-containing protein 19
3swp_C3e-51716117170NAC domain-containing protein 19
3swp_D3e-51716117170NAC domain-containing protein 19
4dul_A3e-51716114167NAC domain-containing protein 19
4dul_B3e-51716114167NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010915633.10.0PREDICTED: NAC domain-containing protein 76-like
SwissprotQ9MA171e-117SMB_ARATH; Protein SOMBRERO
TrEMBLM0RI660.0M0RI66_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P14400_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34613781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.31e-108NAC family protein